Anti AGL pAb (ATL-HPA028498)

Atlas Antibodies

Catalog No.:
ATL-HPA028498-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Gene Name: AGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033400: 95%, ENSRNOG00000016214: 96%
Entrez Gene ID: 178
Uniprot ID: P35573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYMLDAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSL
Gene Sequence EVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYMLDAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSL
Gene ID - Mouse ENSMUSG00000033400
Gene ID - Rat ENSRNOG00000016214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGL pAb (ATL-HPA028498)
Datasheet Anti AGL pAb (ATL-HPA028498) Datasheet (External Link)
Vendor Page Anti AGL pAb (ATL-HPA028498) at Atlas Antibodies

Documents & Links for Anti AGL pAb (ATL-HPA028498)
Datasheet Anti AGL pAb (ATL-HPA028498) Datasheet (External Link)
Vendor Page Anti AGL pAb (ATL-HPA028498)