Anti AGK pAb (ATL-HPA053471)

Atlas Antibodies

SKU:
ATL-HPA053471-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acylglycerol kinase
Gene Name: AGK
Alternative Gene Name: FLJ10842, MULK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029916: 93%, ENSRNOG00000011509: 90%
Entrez Gene ID: 55750
Uniprot ID: Q53H12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQ
Gene Sequence IVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQ
Gene ID - Mouse ENSMUSG00000029916
Gene ID - Rat ENSRNOG00000011509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGK pAb (ATL-HPA053471)
Datasheet Anti AGK pAb (ATL-HPA053471) Datasheet (External Link)
Vendor Page Anti AGK pAb (ATL-HPA053471) at Atlas Antibodies

Documents & Links for Anti AGK pAb (ATL-HPA053471)
Datasheet Anti AGK pAb (ATL-HPA053471) Datasheet (External Link)
Vendor Page Anti AGK pAb (ATL-HPA053471)