Anti AGFG2 pAb (ATL-HPA073562)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073562-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: AGFG2
Alternative Gene Name: HRBL, RABR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029722: 82%, ENSRNOG00000001404: 86%
Entrez Gene ID: 3268
Uniprot ID: O95081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF | 
| Gene Sequence | KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF | 
| Gene ID - Mouse | ENSMUSG00000029722 | 
| Gene ID - Rat | ENSRNOG00000001404 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti AGFG2 pAb (ATL-HPA073562) | |
| Datasheet | Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link) | 
| Vendor Page | Anti AGFG2 pAb (ATL-HPA073562) at Atlas Antibodies | 
| Documents & Links for Anti AGFG2 pAb (ATL-HPA073562) | |
| Datasheet | Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link) | 
| Vendor Page | Anti AGFG2 pAb (ATL-HPA073562) | 
 
         
                             
                                        ![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101141/181196/atl-hpa073562_anti-agfg2-pab-atl-hpa073562_62864__57960.1681137467.jpg?c=2)