Anti AGFG2 pAb (ATL-HPA073562)

Atlas Antibodies

Catalog No.:
ATL-HPA073562-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ArfGAP with FG repeats 2
Gene Name: AGFG2
Alternative Gene Name: HRBL, RABR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029722: 82%, ENSRNOG00000001404: 86%
Entrez Gene ID: 3268
Uniprot ID: O95081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF
Gene Sequence KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF
Gene ID - Mouse ENSMUSG00000029722
Gene ID - Rat ENSRNOG00000001404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGFG2 pAb (ATL-HPA073562)
Datasheet Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link)
Vendor Page Anti AGFG2 pAb (ATL-HPA073562) at Atlas Antibodies

Documents & Links for Anti AGFG2 pAb (ATL-HPA073562)
Datasheet Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link)
Vendor Page Anti AGFG2 pAb (ATL-HPA073562)