Anti AGBL5 pAb (ATL-HPA030981)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030981-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AGBL5
Alternative Gene Name: CCP5, FLJ21839
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029165: 88%, ENSRNOG00000008612: 88%
Entrez Gene ID: 60509
Uniprot ID: Q8NDL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYRRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPR |
| Gene Sequence | TTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYRRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPR |
| Gene ID - Mouse | ENSMUSG00000029165 |
| Gene ID - Rat | ENSRNOG00000008612 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGBL5 pAb (ATL-HPA030981) | |
| Datasheet | Anti AGBL5 pAb (ATL-HPA030981) Datasheet (External Link) |
| Vendor Page | Anti AGBL5 pAb (ATL-HPA030981) at Atlas Antibodies |
| Documents & Links for Anti AGBL5 pAb (ATL-HPA030981) | |
| Datasheet | Anti AGBL5 pAb (ATL-HPA030981) Datasheet (External Link) |
| Vendor Page | Anti AGBL5 pAb (ATL-HPA030981) |
| Citations for Anti AGBL5 pAb (ATL-HPA030981) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |