Anti AGBL5 pAb (ATL-HPA030981)

Atlas Antibodies

Catalog No.:
ATL-HPA030981-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP/GTP binding protein-like 5
Gene Name: AGBL5
Alternative Gene Name: CCP5, FLJ21839
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029165: 88%, ENSRNOG00000008612: 88%
Entrez Gene ID: 60509
Uniprot ID: Q8NDL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYRRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPR
Gene Sequence TTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYRRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPR
Gene ID - Mouse ENSMUSG00000029165
Gene ID - Rat ENSRNOG00000008612
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGBL5 pAb (ATL-HPA030981)
Datasheet Anti AGBL5 pAb (ATL-HPA030981) Datasheet (External Link)
Vendor Page Anti AGBL5 pAb (ATL-HPA030981) at Atlas Antibodies

Documents & Links for Anti AGBL5 pAb (ATL-HPA030981)
Datasheet Anti AGBL5 pAb (ATL-HPA030981) Datasheet (External Link)
Vendor Page Anti AGBL5 pAb (ATL-HPA030981)
Citations for Anti AGBL5 pAb (ATL-HPA030981) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed