Anti AGBL4 pAb (ATL-HPA037994)

Atlas Antibodies

Catalog No.:
ATL-HPA037994-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP/GTP binding protein-like 4
Gene Name: AGBL4
Alternative Gene Name: CCP6, FLJ14442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061298: 96%, ENSRNOG00000010397: 38%
Entrez Gene ID: 84871
Uniprot ID: Q5VU57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPK
Gene Sequence GNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPK
Gene ID - Mouse ENSMUSG00000061298
Gene ID - Rat ENSRNOG00000010397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGBL4 pAb (ATL-HPA037994)
Datasheet Anti AGBL4 pAb (ATL-HPA037994) Datasheet (External Link)
Vendor Page Anti AGBL4 pAb (ATL-HPA037994) at Atlas Antibodies

Documents & Links for Anti AGBL4 pAb (ATL-HPA037994)
Datasheet Anti AGBL4 pAb (ATL-HPA037994) Datasheet (External Link)
Vendor Page Anti AGBL4 pAb (ATL-HPA037994)