Anti AGBL4 pAb (ATL-HPA037994)

Atlas Antibodies

Catalog No.: ATL-HPA037994-25

Protein Description: ATP/GTP binding protein-like 4
Gene Name: AGBL4
Alternative Gene Name: CCP6, FLJ14442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061298: 96%, ENSRNOG00000010397: 38%
Entrez Gene ID: 84871
Uniprot ID: Q5VU57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPK
• Gene Sequence: GNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPK
• Gene ID - Mouse: ENSMUSG00000061298
• Gene ID - Rat: ENSRNOG00000010397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.