Anti AGBL3 pAb (ATL-HPA024150)

Atlas Antibodies

SKU:
ATL-HPA024150-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP/GTP binding protein-like 3
Gene Name: AGBL3
Alternative Gene Name: CCP3, MGC32955
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038836: 87%, ENSRNOG00000010397: 90%
Entrez Gene ID: 340351
Uniprot ID: Q8NEM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILLEYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDE
Gene Sequence DYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILLEYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDE
Gene ID - Mouse ENSMUSG00000038836
Gene ID - Rat ENSRNOG00000010397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGBL3 pAb (ATL-HPA024150)
Datasheet Anti AGBL3 pAb (ATL-HPA024150) Datasheet (External Link)
Vendor Page Anti AGBL3 pAb (ATL-HPA024150) at Atlas Antibodies

Documents & Links for Anti AGBL3 pAb (ATL-HPA024150)
Datasheet Anti AGBL3 pAb (ATL-HPA024150) Datasheet (External Link)
Vendor Page Anti AGBL3 pAb (ATL-HPA024150)