Anti AGBL2 pAb (ATL-HPA007718)

Atlas Antibodies

Catalog No.:
ATL-HPA007718-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP/GTP binding protein-like 2
Gene Name: AGBL2
Alternative Gene Name: CCP2, FLJ23598
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040812: 49%, ENSRNOG00000008467: 47%
Entrez Gene ID: 79841
Uniprot ID: Q5U5Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
Gene Sequence LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
Gene ID - Mouse ENSMUSG00000040812
Gene ID - Rat ENSRNOG00000008467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGBL2 pAb (ATL-HPA007718)
Datasheet Anti AGBL2 pAb (ATL-HPA007718) Datasheet (External Link)
Vendor Page Anti AGBL2 pAb (ATL-HPA007718) at Atlas Antibodies

Documents & Links for Anti AGBL2 pAb (ATL-HPA007718)
Datasheet Anti AGBL2 pAb (ATL-HPA007718) Datasheet (External Link)
Vendor Page Anti AGBL2 pAb (ATL-HPA007718)
Citations for Anti AGBL2 pAb (ATL-HPA007718) – 1 Found
He, Wei-Peng; Wang, Li-Li. High expression of AGBL2 is a novel prognostic factor of adverse outcome in patients with ovarian carcinoma. Oncology Letters. 2019;18(5):4900-4906.  PubMed