Anti AGBL2 pAb (ATL-HPA007718)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007718-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AGBL2
Alternative Gene Name: CCP2, FLJ23598
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040812: 49%, ENSRNOG00000008467: 47%
Entrez Gene ID: 79841
Uniprot ID: Q5U5Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE |
| Gene Sequence | LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE |
| Gene ID - Mouse | ENSMUSG00000040812 |
| Gene ID - Rat | ENSRNOG00000008467 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGBL2 pAb (ATL-HPA007718) | |
| Datasheet | Anti AGBL2 pAb (ATL-HPA007718) Datasheet (External Link) |
| Vendor Page | Anti AGBL2 pAb (ATL-HPA007718) at Atlas Antibodies |
| Documents & Links for Anti AGBL2 pAb (ATL-HPA007718) | |
| Datasheet | Anti AGBL2 pAb (ATL-HPA007718) Datasheet (External Link) |
| Vendor Page | Anti AGBL2 pAb (ATL-HPA007718) |
| Citations for Anti AGBL2 pAb (ATL-HPA007718) – 1 Found |
| He, Wei-Peng; Wang, Li-Li. High expression of AGBL2 is a novel prognostic factor of adverse outcome in patients with ovarian carcinoma. Oncology Letters. 2019;18(5):4900-4906. PubMed |