Anti AGBL2 pAb (ATL-HPA007718)

Atlas Antibodies

Catalog No.: ATL-HPA007718-25

Protein Description: ATP/GTP binding protein-like 2
Gene Name: AGBL2
Alternative Gene Name: CCP2, FLJ23598
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040812: 49%, ENSRNOG00000008467: 47%
Entrez Gene ID: 79841
Uniprot ID: Q5U5Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
• Gene Sequence: LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKE
• Gene ID - Mouse: ENSMUSG00000040812
• Gene ID - Rat: ENSRNOG00000008467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AGBL2 pAb (ATL-HPA007718) – 1 Found

He, Wei-Peng; Wang, Li-Li. High expression of AGBL2 is a novel prognostic factor of adverse outcome in patients with ovarian carcinoma. Oncology Letters. 2019;18(5):4900-4906.