Anti AGAP3 pAb (ATL-HPA012883)

Atlas Antibodies

SKU:
ATL-HPA012883-25
  • Immunohistochemical staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
Gene Name: AGAP3
Alternative Gene Name: CENTG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023353: 100%, ENSRNOG00000012764: 100%
Entrez Gene ID: 116988
Uniprot ID: Q96P47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNPSAE
Gene Sequence AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNPSAE
Gene ID - Mouse ENSMUSG00000023353
Gene ID - Rat ENSRNOG00000012764
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AGAP3 pAb (ATL-HPA012883)
Datasheet Anti AGAP3 pAb (ATL-HPA012883) Datasheet (External Link)
Vendor Page Anti AGAP3 pAb (ATL-HPA012883) at Atlas Antibodies

Documents & Links for Anti AGAP3 pAb (ATL-HPA012883)
Datasheet Anti AGAP3 pAb (ATL-HPA012883) Datasheet (External Link)
Vendor Page Anti AGAP3 pAb (ATL-HPA012883)