Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA075831-25

• 
• 

Protein Description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Gene Name: AGAP2
Alternative Gene Name: CENTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 99%, ENSRNOG00000025584: 100%
Entrez Gene ID: 116986
Uniprot ID: Q99490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS
• Gene Sequence: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS
• Gene ID - Mouse: ENSMUSG00000025422
• Gene ID - Rat: ENSRNOG00000025584
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.