Anti AGAP2 pAb (ATL-HPA023474)

Atlas Antibodies

Catalog No.:
ATL-HPA023474-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Gene Name: AGAP2
Alternative Gene Name: CENTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 95%, ENSRNOG00000025584: 95%
Entrez Gene ID: 116986
Uniprot ID: Q99490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
Gene Sequence PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
Gene ID - Mouse ENSMUSG00000025422
Gene ID - Rat ENSRNOG00000025584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGAP2 pAb (ATL-HPA023474)
Datasheet Anti AGAP2 pAb (ATL-HPA023474) Datasheet (External Link)
Vendor Page Anti AGAP2 pAb (ATL-HPA023474) at Atlas Antibodies

Documents & Links for Anti AGAP2 pAb (ATL-HPA023474)
Datasheet Anti AGAP2 pAb (ATL-HPA023474) Datasheet (External Link)
Vendor Page Anti AGAP2 pAb (ATL-HPA023474)
Citations for Anti AGAP2 pAb (ATL-HPA023474) – 2 Found
Nakken, Sigrid; Eikrem, Øystein; Marti, Hans-Peter; Beisland, Christian; Bostad, Leif; Scherer, Andreas; Flatberg, Arnar; Beisvag, Vidar; Skandalou, Eleni; Furriol, Jessica; Strauss, Philipp. AGAP2-AS1 as a prognostic biomarker in low-risk clear cell renal cell carcinoma patients with progressing disease. Cancer Cell International. 2021;21(1):690.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed