Anti AGAP2 pAb (ATL-HPA023474)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023474-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AGAP2
Alternative Gene Name: CENTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 95%, ENSRNOG00000025584: 95%
Entrez Gene ID: 116986
Uniprot ID: Q99490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE |
| Gene Sequence | PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE |
| Gene ID - Mouse | ENSMUSG00000025422 |
| Gene ID - Rat | ENSRNOG00000025584 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AGAP2 pAb (ATL-HPA023474) | |
| Datasheet | Anti AGAP2 pAb (ATL-HPA023474) Datasheet (External Link) |
| Vendor Page | Anti AGAP2 pAb (ATL-HPA023474) at Atlas Antibodies |
| Documents & Links for Anti AGAP2 pAb (ATL-HPA023474) | |
| Datasheet | Anti AGAP2 pAb (ATL-HPA023474) Datasheet (External Link) |
| Vendor Page | Anti AGAP2 pAb (ATL-HPA023474) |
| Citations for Anti AGAP2 pAb (ATL-HPA023474) – 2 Found |
| Nakken, Sigrid; Eikrem, Øystein; Marti, Hans-Peter; Beisland, Christian; Bostad, Leif; Scherer, Andreas; Flatberg, Arnar; Beisvag, Vidar; Skandalou, Eleni; Furriol, Jessica; Strauss, Philipp. AGAP2-AS1 as a prognostic biomarker in low-risk clear cell renal cell carcinoma patients with progressing disease. Cancer Cell International. 2021;21(1):690. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |