Anti AGA pAb (ATL-HPA031415 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031415-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aspartylglucosaminidase
Gene Name: AGA
Alternative Gene Name: ASRG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031521: 86%, ENSRNOG00000000108: 84%
Entrez Gene ID: 175
Uniprot ID: P20933
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Gene Sequence SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Gene ID - Mouse ENSMUSG00000031521
Gene ID - Rat ENSRNOG00000000108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AGA pAb (ATL-HPA031415 w/enhanced validation)
Datasheet Anti AGA pAb (ATL-HPA031415 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGA pAb (ATL-HPA031415 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AGA pAb (ATL-HPA031415 w/enhanced validation)
Datasheet Anti AGA pAb (ATL-HPA031415 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AGA pAb (ATL-HPA031415 w/enhanced validation)