Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034990-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol, the Golgi apparatus & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and AFTPH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413655).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aftiphilin
Gene Name: AFTPH
Alternative Gene Name: FLJ20080, FLJ23793, MGC33965, Nbla10388
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049659: 79%, ENSRNOG00000005411: 84%
Entrez Gene ID: 54812
Uniprot ID: Q6ULP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
Gene Sequence DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
Gene ID - Mouse ENSMUSG00000049659
Gene ID - Rat ENSRNOG00000005411
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation)
Datasheet Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation)
Datasheet Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation)