Anti AFP pAb (ATL-HPA010607 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA010607-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: alpha-fetoprotein
Gene Name: AFP
Alternative Gene Name: FETA, HPAFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054932: 59%, ENSRNOG00000002889: 57%
Entrez Gene ID: 174
Uniprot ID: P02771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR
Gene Sequence FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR
Gene ID - Mouse ENSMUSG00000054932
Gene ID - Rat ENSRNOG00000002889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AFP pAb (ATL-HPA010607 w/enhanced validation)
Datasheet Anti AFP pAb (ATL-HPA010607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFP pAb (ATL-HPA010607 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AFP pAb (ATL-HPA010607 w/enhanced validation)
Datasheet Anti AFP pAb (ATL-HPA010607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFP pAb (ATL-HPA010607 w/enhanced validation)
Citations for Anti AFP pAb (ATL-HPA010607 w/enhanced validation) – 3 Found
Inada, Emi; Saitoh, Issei; Kubota, Naoko; Iwase, Yoko; Murakami, Tomoya; Sawami, Tadashi; Yamasaki, Youichi; Sato, Masahiro. Increased Expression of Cell Surface SSEA-1 is Closely Associated with Naïve-Like Conversion from Human Deciduous Teeth Dental Pulp Cells-Derived iPS Cells. International Journal Of Molecular Sciences. 2019;20(7)  PubMed
Shimamoto, Akira; Kagawa, Harunobu; Zensho, Kazumasa; Sera, Yukihiro; Kazuki, Yasuhiro; Osaki, Mitsuhiko; Oshimura, Mitsuo; Ishigaki, Yasuhito; Hamasaki, Kanya; Kodama, Yoshiaki; Yuasa, Shinsuke; Fukuda, Keiichi; Hirashima, Kyotaro; Seimiya, Hiroyuki; Koyama, Hirofumi; Shimizu, Takahiko; Takemoto, Minoru; Yokote, Koutaro; Goto, Makoto; Tahara, Hidetoshi. Reprogramming suppresses premature senescence phenotypes of Werner syndrome cells and maintains chromosomal stability over long-term culture. Plos One. 9(11):e112900.  PubMed
Inada, Emi; Saitoh, Issei; Watanabe, Satoshi; Aoki, Reiji; Miura, Hiromi; Ohtsuka, Masato; Murakami, Tomoya; Sawami, Tadashi; Yamasaki, Youichi; Sato, Masahiro. PiggyBac transposon-mediated gene delivery efficiently generates stable transfectants derived from cultured primary human deciduous tooth dental pulp cells (HDDPCs) and HDDPC-derived iPS cells. International Journal Of Oral Science. 2015;7(3):144-54.  PubMed