Anti AFP pAb (ATL-HPA010607 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010607-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: AFP
Alternative Gene Name: FETA, HPAFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054932: 59%, ENSRNOG00000002889: 57%
Entrez Gene ID: 174
Uniprot ID: P02771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR |
| Gene Sequence | FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR |
| Gene ID - Mouse | ENSMUSG00000054932 |
| Gene ID - Rat | ENSRNOG00000002889 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFP pAb (ATL-HPA010607 w/enhanced validation) | |
| Datasheet | Anti AFP pAb (ATL-HPA010607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AFP pAb (ATL-HPA010607 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AFP pAb (ATL-HPA010607 w/enhanced validation) | |
| Datasheet | Anti AFP pAb (ATL-HPA010607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AFP pAb (ATL-HPA010607 w/enhanced validation) |
| Citations for Anti AFP pAb (ATL-HPA010607 w/enhanced validation) – 3 Found |
| Inada, Emi; Saitoh, Issei; Kubota, Naoko; Iwase, Yoko; Murakami, Tomoya; Sawami, Tadashi; Yamasaki, Youichi; Sato, Masahiro. Increased Expression of Cell Surface SSEA-1 is Closely Associated with Naïve-Like Conversion from Human Deciduous Teeth Dental Pulp Cells-Derived iPS Cells. International Journal Of Molecular Sciences. 2019;20(7) PubMed |
| Shimamoto, Akira; Kagawa, Harunobu; Zensho, Kazumasa; Sera, Yukihiro; Kazuki, Yasuhiro; Osaki, Mitsuhiko; Oshimura, Mitsuo; Ishigaki, Yasuhito; Hamasaki, Kanya; Kodama, Yoshiaki; Yuasa, Shinsuke; Fukuda, Keiichi; Hirashima, Kyotaro; Seimiya, Hiroyuki; Koyama, Hirofumi; Shimizu, Takahiko; Takemoto, Minoru; Yokote, Koutaro; Goto, Makoto; Tahara, Hidetoshi. Reprogramming suppresses premature senescence phenotypes of Werner syndrome cells and maintains chromosomal stability over long-term culture. Plos One. 9(11):e112900. PubMed |
| Inada, Emi; Saitoh, Issei; Watanabe, Satoshi; Aoki, Reiji; Miura, Hiromi; Ohtsuka, Masato; Murakami, Tomoya; Sawami, Tadashi; Yamasaki, Youichi; Sato, Masahiro. PiggyBac transposon-mediated gene delivery efficiently generates stable transfectants derived from cultured primary human deciduous tooth dental pulp cells (HDDPCs) and HDDPC-derived iPS cells. International Journal Of Oral Science. 2015;7(3):144-54. PubMed |