Anti AFMID pAb (ATL-HPA023861)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023861-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: AFMID
Alternative Gene Name: DKFZp686F03259, KF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017718: 49%, ENSRNOG00000050205: 48%
Entrez Gene ID: 125061
Uniprot ID: Q63HM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD |
Gene Sequence | VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD |
Gene ID - Mouse | ENSMUSG00000017718 |
Gene ID - Rat | ENSRNOG00000050205 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AFMID pAb (ATL-HPA023861) | |
Datasheet | Anti AFMID pAb (ATL-HPA023861) Datasheet (External Link) |
Vendor Page | Anti AFMID pAb (ATL-HPA023861) at Atlas Antibodies |
Documents & Links for Anti AFMID pAb (ATL-HPA023861) | |
Datasheet | Anti AFMID pAb (ATL-HPA023861) Datasheet (External Link) |
Vendor Page | Anti AFMID pAb (ATL-HPA023861) |