Anti AFMID pAb (ATL-HPA023861)

Atlas Antibodies

SKU:
ATL-HPA023861-100
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: arylformamidase
Gene Name: AFMID
Alternative Gene Name: DKFZp686F03259, KF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017718: 49%, ENSRNOG00000050205: 48%
Entrez Gene ID: 125061
Uniprot ID: Q63HM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
Gene Sequence VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
Gene ID - Mouse ENSMUSG00000017718
Gene ID - Rat ENSRNOG00000050205
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AFMID pAb (ATL-HPA023861)
Datasheet Anti AFMID pAb (ATL-HPA023861) Datasheet (External Link)
Vendor Page Anti AFMID pAb (ATL-HPA023861) at Atlas Antibodies

Documents & Links for Anti AFMID pAb (ATL-HPA023861)
Datasheet Anti AFMID pAb (ATL-HPA023861) Datasheet (External Link)
Vendor Page Anti AFMID pAb (ATL-HPA023861)