Anti AFF4 pAb (ATL-HPA023690)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023690-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AFF4
Alternative Gene Name: AF5Q31, MCEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049470: 91%, ENSRNOG00000006965: 91%
Entrez Gene ID: 27125
Uniprot ID: Q9UHB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS |
Gene Sequence | QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS |
Gene ID - Mouse | ENSMUSG00000049470 |
Gene ID - Rat | ENSRNOG00000006965 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AFF4 pAb (ATL-HPA023690) | |
Datasheet | Anti AFF4 pAb (ATL-HPA023690) Datasheet (External Link) |
Vendor Page | Anti AFF4 pAb (ATL-HPA023690) at Atlas Antibodies |
Documents & Links for Anti AFF4 pAb (ATL-HPA023690) | |
Datasheet | Anti AFF4 pAb (ATL-HPA023690) Datasheet (External Link) |
Vendor Page | Anti AFF4 pAb (ATL-HPA023690) |