Anti AFF4 pAb (ATL-HPA023690)

Atlas Antibodies

Catalog No.:
ATL-HPA023690-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AF4/FMR2 family, member 4
Gene Name: AFF4
Alternative Gene Name: AF5Q31, MCEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049470: 91%, ENSRNOG00000006965: 91%
Entrez Gene ID: 27125
Uniprot ID: Q9UHB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS
Gene Sequence QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS
Gene ID - Mouse ENSMUSG00000049470
Gene ID - Rat ENSRNOG00000006965
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AFF4 pAb (ATL-HPA023690)
Datasheet Anti AFF4 pAb (ATL-HPA023690) Datasheet (External Link)
Vendor Page Anti AFF4 pAb (ATL-HPA023690) at Atlas Antibodies

Documents & Links for Anti AFF4 pAb (ATL-HPA023690)
Datasheet Anti AFF4 pAb (ATL-HPA023690) Datasheet (External Link)
Vendor Page Anti AFF4 pAb (ATL-HPA023690)