Anti AFF1 pAb (ATL-HPA069947)

Atlas Antibodies

Catalog No.:
ATL-HPA069947-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: AF4/FMR2 family, member 1
Gene Name: AFF1
Alternative Gene Name: AF-4, AF4, MLLT2, PBM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029313: 73%, ENSRNOG00000002232: 80%
Entrez Gene ID: 4299
Uniprot ID: P51825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Gene Sequence VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Gene ID - Mouse ENSMUSG00000029313
Gene ID - Rat ENSRNOG00000002232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AFF1 pAb (ATL-HPA069947)
Datasheet Anti AFF1 pAb (ATL-HPA069947) Datasheet (External Link)
Vendor Page Anti AFF1 pAb (ATL-HPA069947) at Atlas Antibodies

Documents & Links for Anti AFF1 pAb (ATL-HPA069947)
Datasheet Anti AFF1 pAb (ATL-HPA069947) Datasheet (External Link)
Vendor Page Anti AFF1 pAb (ATL-HPA069947)