Anti AFF1 pAb (ATL-HPA069947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069947-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AFF1
Alternative Gene Name: AF-4, AF4, MLLT2, PBM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029313: 73%, ENSRNOG00000002232: 80%
Entrez Gene ID: 4299
Uniprot ID: P51825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK |
Gene Sequence | VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK |
Gene ID - Mouse | ENSMUSG00000029313 |
Gene ID - Rat | ENSRNOG00000002232 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AFF1 pAb (ATL-HPA069947) | |
Datasheet | Anti AFF1 pAb (ATL-HPA069947) Datasheet (External Link) |
Vendor Page | Anti AFF1 pAb (ATL-HPA069947) at Atlas Antibodies |
Documents & Links for Anti AFF1 pAb (ATL-HPA069947) | |
Datasheet | Anti AFF1 pAb (ATL-HPA069947) Datasheet (External Link) |
Vendor Page | Anti AFF1 pAb (ATL-HPA069947) |