Anti AFDN pAb (ATL-HPA049868)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049868-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 92%, ENSRNOG00000023753: 37%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS |
| Gene Sequence | DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS |
| Gene ID - Mouse | ENSMUSG00000068036 |
| Gene ID - Rat | ENSRNOG00000023753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AFDN pAb (ATL-HPA049868) | |
| Datasheet | Anti AFDN pAb (ATL-HPA049868) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA049868) at Atlas Antibodies |
| Documents & Links for Anti AFDN pAb (ATL-HPA049868) | |
| Datasheet | Anti AFDN pAb (ATL-HPA049868) Datasheet (External Link) |
| Vendor Page | Anti AFDN pAb (ATL-HPA049868) |
| Citations for Anti AFDN pAb (ATL-HPA049868) – 1 Found |
| Tsurumi, Haruko; Kurihara, Hidetake; Miura, Kenichiro; Tanego, Atsushi; Ohta, Yasutaka; Igarashi, Takashi; Oka, Akira; Horita, Shigeru; Hattori, Motoshi; Harita, Yutaka. Afadin is localized at cell-cell contact sites in mesangial cells and regulates migratory polarity. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2016;96(1):49-59. PubMed |