Anti AFDN pAb (ATL-HPA049868)

Atlas Antibodies

Catalog No.:
ATL-HPA049868-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: afadin, adherens junction formation factor
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 92%, ENSRNOG00000023753: 37%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS
Gene Sequence DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS
Gene ID - Mouse ENSMUSG00000068036
Gene ID - Rat ENSRNOG00000023753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AFDN pAb (ATL-HPA049868)
Datasheet Anti AFDN pAb (ATL-HPA049868) Datasheet (External Link)
Vendor Page Anti AFDN pAb (ATL-HPA049868) at Atlas Antibodies

Documents & Links for Anti AFDN pAb (ATL-HPA049868)
Datasheet Anti AFDN pAb (ATL-HPA049868) Datasheet (External Link)
Vendor Page Anti AFDN pAb (ATL-HPA049868)
Citations for Anti AFDN pAb (ATL-HPA049868) – 1 Found
Tsurumi, Haruko; Kurihara, Hidetake; Miura, Kenichiro; Tanego, Atsushi; Ohta, Yasutaka; Igarashi, Takashi; Oka, Akira; Horita, Shigeru; Hattori, Motoshi; Harita, Yutaka. Afadin is localized at cell-cell contact sites in mesangial cells and regulates migratory polarity. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2016;96(1):49-59.  PubMed