Anti AFDN pAb (ATL-HPA030214)

Atlas Antibodies

SKU: ATL-HPA030214-25

• 

Protein Description: afadin, adherens junction formation factor
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 96%, ENSRNOG00000023753: 88%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP
• Gene Sequence: DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP
• Gene ID - Mouse: ENSMUSG00000068036
• Gene ID - Rat: ENSRNOG00000023753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.