Anti AFDN pAb (ATL-HPA030214)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030214-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 96%, ENSRNOG00000023753: 88%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP |
Gene Sequence | DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP |
Gene ID - Mouse | ENSMUSG00000068036 |
Gene ID - Rat | ENSRNOG00000023753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AFDN pAb (ATL-HPA030214) | |
Datasheet | Anti AFDN pAb (ATL-HPA030214) Datasheet (External Link) |
Vendor Page | Anti AFDN pAb (ATL-HPA030214) at Atlas Antibodies |
Documents & Links for Anti AFDN pAb (ATL-HPA030214) | |
Datasheet | Anti AFDN pAb (ATL-HPA030214) Datasheet (External Link) |
Vendor Page | Anti AFDN pAb (ATL-HPA030214) |