Anti AFDN pAb (ATL-HPA030213)

Atlas Antibodies

Catalog No.: ATL-HPA030213-25

Protein Description: afadin, adherens junction formation factor
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 93%, ENSRNOG00000023753: 94%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ
• Gene Sequence: KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ
• Gene ID - Mouse: ENSMUSG00000068036
• Gene ID - Rat: ENSRNOG00000023753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AFDN pAb (ATL-HPA030213) – 1 Found

Marques, Miguel Sardinha; Melo, Joana; Cavadas, Bruno; Mendes, Nuno; Pereira, Luísa; Carneiro, Fátima; Figueiredo, Ceu; Leite, Marina. Afadin Downregulation by Helicobacter pylori Induces Epithelial to Mesenchymal Transition in Gastric Cells. Frontiers In Microbiology. 9( 30473688):2712.