Anti AFDN pAb (ATL-HPA030212)

Atlas Antibodies

Catalog No.:
ATL-HPA030212-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: afadin, adherens junction formation factor
Gene Name: AFDN
Alternative Gene Name: AF-6, AF6, MLLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068036: 84%, ENSRNOG00000023753: 87%
Entrez Gene ID: 4301
Uniprot ID: P55196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD
Gene Sequence ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD
Gene ID - Mouse ENSMUSG00000068036
Gene ID - Rat ENSRNOG00000023753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AFDN pAb (ATL-HPA030212)
Datasheet Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link)
Vendor Page Anti AFDN pAb (ATL-HPA030212) at Atlas Antibodies

Documents & Links for Anti AFDN pAb (ATL-HPA030212)
Datasheet Anti AFDN pAb (ATL-HPA030212) Datasheet (External Link)
Vendor Page Anti AFDN pAb (ATL-HPA030212)
Citations for Anti AFDN pAb (ATL-HPA030212) – 2 Found
Tabariès, Sébastien; McNulty, Alexander; Ouellet, Véronique; Annis, Matthew G; Dessureault, Mireille; Vinette, Maude; Hachem, Yasmina; Lavoie, Brennan; Omeroglu, Atilla; Simon, Hans-Georg; Walsh, Logan A; Kimbung, Siker; Hedenfalk, Ingrid; Siegel, Peter M. Afadin cooperates with Claudin-2 to promote breast cancer metastasis. Genes & Development. 2019;33(3-4):180-193.  PubMed
Labernadie, Anna; Kato, Takuya; Brugués, Agustí; Serra-Picamal, Xavier; Derzsi, Stefanie; Arwert, Esther; Weston, Anne; González-Tarragó, Victor; Elosegui-Artola, Alberto; Albertazzi, Lorenzo; Alcaraz, Jordi; Roca-Cusachs, Pere; Sahai, Erik; Trepat, Xavier. A mechanically active heterotypic E-cadherin/N-cadherin adhesion enables fibroblasts to drive cancer cell invasion. Nature Cell Biology. 2017;19(3):224-237.  PubMed