Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA015642-25
  • Immunohistochemistry analysis in human colon and liver tissues using HPA015642 antibody. Corresponding AFAP1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm, actin filaments & focal adhesion sites.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin filament associated protein 1
Gene Name: AFAP1
Alternative Gene Name: AFAP, AFAP-110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029094: 80%, ENSRNOG00000060665: 79%
Entrez Gene ID: 60312
Uniprot ID: Q8N556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKR
Gene Sequence PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKR
Gene ID - Mouse ENSMUSG00000029094
Gene ID - Rat ENSRNOG00000060665
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation)
Datasheet Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation)
Datasheet Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AFAP1 pAb (ATL-HPA015642 w/enhanced validation)