Anti AF165138.7 pAb (ATL-HPA046639)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046639-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: AF165138.7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020422: 29%, ENSRNOG00000025695: 29%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KTVNDKIWQEHSKHKNDSHIRRPCQLKDLNEDDFLSNNIHTYQGKTLQGTSYQVTSECWSPFHYQRHVETTVDELVRHFFPDVT |
| Gene Sequence | KTVNDKIWQEHSKHKNDSHIRRPCQLKDLNEDDFLSNNIHTYQGKTLQGTSYQVTSECWSPFHYQRHVETTVDELVRHFFPDVT |
| Gene ID - Mouse | ENSMUSG00000020422 |
| Gene ID - Rat | ENSRNOG00000025695 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AF165138.7 pAb (ATL-HPA046639) | |
| Datasheet | Anti AF165138.7 pAb (ATL-HPA046639) Datasheet (External Link) |
| Vendor Page | Anti AF165138.7 pAb (ATL-HPA046639) at Atlas Antibodies |
| Documents & Links for Anti AF165138.7 pAb (ATL-HPA046639) | |
| Datasheet | Anti AF165138.7 pAb (ATL-HPA046639) Datasheet (External Link) |
| Vendor Page | Anti AF165138.7 pAb (ATL-HPA046639) |