Anti AEBP2 pAb (ATL-HPA022282)

Atlas Antibodies

SKU: ATL-HPA022282-25

• 
• 
• 

Protein Description: AE binding protein 2
Gene Name: AEBP2
Alternative Gene Name: MGC17922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030232: 99%, ENSRNOG00000008929: 79%
Entrez Gene ID: 121536
Uniprot ID: Q6ZN18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK
• Gene Sequence: LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK
• Gene ID - Mouse: ENSMUSG00000030232
• Gene ID - Rat: ENSRNOG00000008929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.