Anti AEBP2 pAb (ATL-HPA022282)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022282-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AEBP2
Alternative Gene Name: MGC17922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030232: 99%, ENSRNOG00000008929: 79%
Entrez Gene ID: 121536
Uniprot ID: Q6ZN18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK |
| Gene Sequence | LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK |
| Gene ID - Mouse | ENSMUSG00000030232 |
| Gene ID - Rat | ENSRNOG00000008929 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AEBP2 pAb (ATL-HPA022282) | |
| Datasheet | Anti AEBP2 pAb (ATL-HPA022282) Datasheet (External Link) |
| Vendor Page | Anti AEBP2 pAb (ATL-HPA022282) at Atlas Antibodies |
| Documents & Links for Anti AEBP2 pAb (ATL-HPA022282) | |
| Datasheet | Anti AEBP2 pAb (ATL-HPA022282) Datasheet (External Link) |
| Vendor Page | Anti AEBP2 pAb (ATL-HPA022282) |