Anti AEBP2 pAb (ATL-HPA022282)

Atlas Antibodies

SKU:
ATL-HPA022282-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus.
  • Western blot analysis in human cell line BEWO.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AE binding protein 2
Gene Name: AEBP2
Alternative Gene Name: MGC17922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030232: 99%, ENSRNOG00000008929: 79%
Entrez Gene ID: 121536
Uniprot ID: Q6ZN18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK
Gene Sequence LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSK
Gene ID - Mouse ENSMUSG00000030232
Gene ID - Rat ENSRNOG00000008929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AEBP2 pAb (ATL-HPA022282)
Datasheet Anti AEBP2 pAb (ATL-HPA022282) Datasheet (External Link)
Vendor Page Anti AEBP2 pAb (ATL-HPA022282) at Atlas Antibodies

Documents & Links for Anti AEBP2 pAb (ATL-HPA022282)
Datasheet Anti AEBP2 pAb (ATL-HPA022282) Datasheet (External Link)
Vendor Page Anti AEBP2 pAb (ATL-HPA022282)