Anti AEBP1 pAb (ATL-HPA064970)

Atlas Antibodies

Catalog No.:
ATL-HPA064970-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: AE binding protein 1
Gene Name: AEBP1
Alternative Gene Name: ACLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020473: 75%, ENSRNOG00000013720: 77%
Entrez Gene ID: 165
Uniprot ID: Q8IUX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Gene Sequence PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Gene ID - Mouse ENSMUSG00000020473
Gene ID - Rat ENSRNOG00000013720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AEBP1 pAb (ATL-HPA064970)
Datasheet Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link)
Vendor Page Anti AEBP1 pAb (ATL-HPA064970) at Atlas Antibodies

Documents & Links for Anti AEBP1 pAb (ATL-HPA064970)
Datasheet Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link)
Vendor Page Anti AEBP1 pAb (ATL-HPA064970)
Citations for Anti AEBP1 pAb (ATL-HPA064970) – 1 Found
Caetano, Ana J; Yianni, Val; Volponi, Ana; Booth, Veronica; D'Agostino, Eleanor M; Sharpe, Paul. Defining human mesenchymal and epithelial heterogeneity in response to oral inflammatory disease. Elife. 2021;10( 33393902)  PubMed