Anti ADSS pAb (ATL-HPA024400 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024400-25

• 
• 
• 

Protein Description: adenylosuccinate synthase
Gene Name: ADSS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015961: 96%, ENSRNOG00000004481: 96%
Entrez Gene ID: 159
Uniprot ID: P30520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
• Gene Sequence: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
• Gene ID - Mouse: ENSMUSG00000015961
• Gene ID - Rat: ENSRNOG00000004481
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADSS pAb (ATL-HPA024400 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.