Anti ADSL pAb (ATL-HPA000525 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA000525-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022407: 92%, ENSRNOG00000018655: 92%
Entrez Gene ID: 158
Uniprot ID: P30566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA |
Gene Sequence | RRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA |
Gene ID - Mouse | ENSMUSG00000022407 |
Gene ID - Rat | ENSRNOG00000018655 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) | |
Datasheet | Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) | |
Datasheet | Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) |
Citations for Anti ADSL pAb (ATL-HPA000525 w/enhanced validation) – 6 Found |
Baresova, Veronika; Skopova, Vaclava; Sikora, Jakub; Patterson, David; Sovova, Jana; Zikanova, Marie; Kmoch, Stanislav. Mutations of ATIC and ADSL affect purinosome assembly in cultured skin fibroblasts from patients with AICA-ribosiduria and ADSL deficiency. Human Molecular Genetics. 2012;21(7):1534-43. PubMed |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
Moreno, Paula; Jiménez-Jiménez, Carla; Garrido-Rodríguez, Martín; Calderón-Santiago, Mónica; Molina, Susana; Lara-Chica, Maribel; Priego-Capote, Feliciano; Salvatierra, Ángel; Muñoz, Eduardo; Calzado, Marco A. Metabolomic profiling of human lung tumor tissues - nucleotide metabolism as a candidate for therapeutic interventions and biomarkers. Molecular Oncology. 2018;12(10):1778-1796. PubMed |
Zurlo, Giada; Liu, Xijuan; Takada, Mamoru; Fan, Cheng; Simon, Jeremy M; Ptacek, Travis S; Rodriguez, Javier; von Kriegsheim, Alex; Liu, Juan; Locasale, Jason W; Robinson, Adam; Zhang, Jing; Holler, Jessica M; Kim, Baek; Zikánová, Marie; Bierau, Jörgen; Xie, Ling; Chen, Xian; Li, Mingjie; Perou, Charles M; Zhang, Qing. Prolyl hydroxylase substrate adenylosuccinate lyase is an oncogenic driver in triple negative breast cancer. Nature Communications. 2019;10(1):5177. PubMed |
Dutto, Ilaria; Gerhards, Julian; Herrera, Antonio; Souckova, Olga; Škopová, Václava; Smak, Jordann A; Junza, Alexandra; Yanes, Oscar; Boeckx, Cedric; Burkhalter, Martin D; Zikánová, Marie; Pons, Sebastian; Philipp, Melanie; Lüders, Jens; Stracker, Travis H. Pathway-specific effects of ADSL deficiency on neurodevelopment. Elife. 2022;11( 35133277) PubMed |
Zhang, Wen Cai; Skiados, Nicholas; Aftab, Fareesa; Moreno, Cerena; Silva, Luis; Corbilla, Paul Joshua Anthony; Asara, John M; Hata, Aaron N; Slack, Frank J. MicroRNA-21 guide and passenger strand regulation of adenylosuccinate lyase-mediated purine metabolism promotes transition to an EGFR-TKI-tolerant persister state. Cancer Gene Therapy. 2022;29(12):1878-1894. PubMed |