Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042266-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ADRM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406279).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adhesion regulating molecule 1
Gene Name: ADRM1
Alternative Gene Name: ARM1, GP110, Rpn13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039041: 98%, ENSRNOG00000055984: 97%
Entrez Gene ID: 11047
Uniprot ID: Q16186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQ
Gene Sequence ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQ
Gene ID - Mouse ENSMUSG00000039041
Gene ID - Rat ENSRNOG00000055984
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation)
Datasheet Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation)
Datasheet Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADRM1 pAb (ATL-HPA042266 w/enhanced validation)