Anti ADRA2B pAb (ATL-HPA074948)

Atlas Antibodies

Catalog No.:
ATL-HPA074948-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adrenoceptor alpha 2B
Gene Name: ADRA2B
Alternative Gene Name: ADRA2L1, ADRA2RL1, ADRARL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058620: 78%, ENSRNOG00000013887: 81%
Entrez Gene ID: 151
Uniprot ID: P18089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
Gene Sequence SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
Gene ID - Mouse ENSMUSG00000058620
Gene ID - Rat ENSRNOG00000013887
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADRA2B pAb (ATL-HPA074948)
Datasheet Anti ADRA2B pAb (ATL-HPA074948) Datasheet (External Link)
Vendor Page Anti ADRA2B pAb (ATL-HPA074948) at Atlas Antibodies

Documents & Links for Anti ADRA2B pAb (ATL-HPA074948)
Datasheet Anti ADRA2B pAb (ATL-HPA074948) Datasheet (External Link)
Vendor Page Anti ADRA2B pAb (ATL-HPA074948)