Anti ADRA1D pAb (ATL-HPA038789)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038789-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ADRA1D
Alternative Gene Name: ADRA1, ADRA1A, ADRA1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027335: 75%, ENSRNOG00000021256: 78%
Entrez Gene ID: 146
Uniprot ID: P25100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE |
| Gene Sequence | PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE |
| Gene ID - Mouse | ENSMUSG00000027335 |
| Gene ID - Rat | ENSRNOG00000021256 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADRA1D pAb (ATL-HPA038789) | |
| Datasheet | Anti ADRA1D pAb (ATL-HPA038789) Datasheet (External Link) |
| Vendor Page | Anti ADRA1D pAb (ATL-HPA038789) at Atlas Antibodies |
| Documents & Links for Anti ADRA1D pAb (ATL-HPA038789) | |
| Datasheet | Anti ADRA1D pAb (ATL-HPA038789) Datasheet (External Link) |
| Vendor Page | Anti ADRA1D pAb (ATL-HPA038789) |