Anti ADRA1D pAb (ATL-HPA038789)

Atlas Antibodies

Catalog No.: ATL-HPA038789-25

Protein Description: adrenoceptor alpha 1D
Gene Name: ADRA1D
Alternative Gene Name: ADRA1, ADRA1A, ADRA1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027335: 75%, ENSRNOG00000021256: 78%
Entrez Gene ID: 146
Uniprot ID: P25100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
• Gene Sequence: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
• Gene ID - Mouse: ENSMUSG00000027335
• Gene ID - Rat: ENSRNOG00000021256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.