Anti ADRA1D pAb (ATL-HPA038789)

Atlas Antibodies

Catalog No.:
ATL-HPA038789-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adrenoceptor alpha 1D
Gene Name: ADRA1D
Alternative Gene Name: ADRA1, ADRA1A, ADRA1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027335: 75%, ENSRNOG00000021256: 78%
Entrez Gene ID: 146
Uniprot ID: P25100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
Gene Sequence PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
Gene ID - Mouse ENSMUSG00000027335
Gene ID - Rat ENSRNOG00000021256
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADRA1D pAb (ATL-HPA038789)
Datasheet Anti ADRA1D pAb (ATL-HPA038789) Datasheet (External Link)
Vendor Page Anti ADRA1D pAb (ATL-HPA038789) at Atlas Antibodies

Documents & Links for Anti ADRA1D pAb (ATL-HPA038789)
Datasheet Anti ADRA1D pAb (ATL-HPA038789) Datasheet (External Link)
Vendor Page Anti ADRA1D pAb (ATL-HPA038789)