Anti ADRA1B pAb (ATL-HPA074416)

Atlas Antibodies

Catalog No.:
ATL-HPA074416-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adrenoceptor alpha 1B
Gene Name: ADRA1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050541: 96%, ENSRNOG00000060087: 94%
Entrez Gene ID: 147
Uniprot ID: P35368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG
Gene Sequence MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG
Gene ID - Mouse ENSMUSG00000050541
Gene ID - Rat ENSRNOG00000060087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADRA1B pAb (ATL-HPA074416)
Datasheet Anti ADRA1B pAb (ATL-HPA074416) Datasheet (External Link)
Vendor Page Anti ADRA1B pAb (ATL-HPA074416) at Atlas Antibodies

Documents & Links for Anti ADRA1B pAb (ATL-HPA074416)
Datasheet Anti ADRA1B pAb (ATL-HPA074416) Datasheet (External Link)
Vendor Page Anti ADRA1B pAb (ATL-HPA074416)