Anti ADPRS pAb (ATL-HPA026641)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026641-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: ADPRS
Alternative Gene Name: ARH3, FLJ20446, ADPRHL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042558: 98%, ENSRNOG00000010849: 95%
Entrez Gene ID: 54936
Uniprot ID: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES |
| Gene Sequence | FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES |
| Gene ID - Mouse | ENSMUSG00000042558 |
| Gene ID - Rat | ENSRNOG00000010849 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADPRS pAb (ATL-HPA026641) | |
| Datasheet | Anti ADPRS pAb (ATL-HPA026641) Datasheet (External Link) |
| Vendor Page | Anti ADPRS pAb (ATL-HPA026641) at Atlas Antibodies |
| Documents & Links for Anti ADPRS pAb (ATL-HPA026641) | |
| Datasheet | Anti ADPRS pAb (ATL-HPA026641) Datasheet (External Link) |
| Vendor Page | Anti ADPRS pAb (ATL-HPA026641) |