Anti ADPRS pAb (ATL-HPA026641)

Atlas Antibodies

SKU:
ATL-HPA026641-100
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylhydrolase like 2
Gene Name: ADPRS
Alternative Gene Name: ARH3, FLJ20446, ADPRHL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042558: 98%, ENSRNOG00000010849: 95%
Entrez Gene ID: 54936
Uniprot ID: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES
Gene Sequence FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES
Gene ID - Mouse ENSMUSG00000042558
Gene ID - Rat ENSRNOG00000010849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADPRS pAb (ATL-HPA026641)
Datasheet Anti ADPRS pAb (ATL-HPA026641) Datasheet (External Link)
Vendor Page Anti ADPRS pAb (ATL-HPA026641) at Atlas Antibodies

Documents & Links for Anti ADPRS pAb (ATL-HPA026641)
Datasheet Anti ADPRS pAb (ATL-HPA026641) Datasheet (External Link)
Vendor Page Anti ADPRS pAb (ATL-HPA026641)