Anti ADPRM pAb (ATL-HPA023265 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023265-25

• 
• 

Protein Description: ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent
Gene Name: ADPRM
Alternative Gene Name: C17orf48, MDS006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020910: 94%, ENSRNOG00000003397: 94%
Entrez Gene ID: 56985
Uniprot ID: Q3LIE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYP
• Gene Sequence: QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYP
• Gene ID - Mouse: ENSMUSG00000020910
• Gene ID - Rat: ENSRNOG00000003397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.