Anti ADPRHL2 pAb (ATL-HPA027141 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027141-25

• 
• 
• 

Protein Description: ADP-ribosylhydrolase like 2
Gene Name: ADPRHL2
Alternative Gene Name: ARH3, FLJ20446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042558: 88%, ENSRNOG00000010849: 88%
Entrez Gene ID: 54936
Uniprot ID: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
• Gene Sequence: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
• Gene ID - Mouse: ENSMUSG00000042558
• Gene ID - Rat: ENSRNOG00000010849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADPRHL2 pAb (ATL-HPA027141 w/enhanced validation) – 2 Found

Danhauser, Katharina; Alhaddad, Bader; Makowski, Christine; Piekutowska-Abramczuk, Dorota; Syrbe, Steffen; Gomez-Ospina, Natalia; Manning, Melanie A; Kostera-Pruszczyk, Anna; Krahn-Peper, Claudia; Berutti, Riccardo; Kovács-Nagy, Reka; Gusic, Mirjana; Graf, Elisabeth; Laugwitz, Lucia; Röblitz, Michaela; Wroblewski, Andreas; Hartmann, Hans; Das, Anibh M; Bültmann, Eva; Fang, Fang; Xu, Manting; Schatz, Ulrich A; Karall, Daniela; Zellner, Herta; Haberlandt, Edda; Feichtinger, René G; Mayr, Johannes A; Meitinger, Thomas; Prokisch, Holger; Strom, Tim M; Płoski, Rafał; Hoffmann, Georg F; Pronicki, Maciej; Bonnen, Penelope E; Morlot, Susanne; Haack, Tobias B. Bi-allelic ADPRHL2 Mutations Cause Neurodegeneration with Developmental Delay, Ataxia, and Axonal Neuropathy. American Journal Of Human Genetics. 2018;103(5):817-825. 

Niere, Marc; Mashimo, Masato; Agledal, Line; Dölle, Christian; Kasamatsu, Atsushi; Kato, Jiro; Moss, Joel; Ziegler, Mathias. ADP-ribosylhydrolase 3 (ARH3), not poly(ADP-ribose) glycohydrolase (PARG) isoforms, is responsible for degradation of mitochondrial matrix-associated poly(ADP-ribose). The Journal Of Biological Chemistry. 2012;287(20):16088-102.