Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027104-25

• 
• 
• 

Protein Description: ADP-ribosylhydrolase like 2
Gene Name: ADPRHL2
Alternative Gene Name: ARH3, FLJ20446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042558: 91%, ENSRNOG00000010849: 91%
Entrez Gene ID: 54936
Uniprot ID: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
• Gene Sequence: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
• Gene ID - Mouse: ENSMUSG00000042558
• Gene ID - Rat: ENSRNOG00000010849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADPRHL2 pAb (ATL-HPA027104 w/enhanced validation) – 5 Found

Fontana, Pietro; Bonfiglio, Juan José; Palazzo, Luca; Bartlett, Edward; Matic, Ivan; Ahel, Ivan. Serine ADP-ribosylation reversal by the hydrolase ARH3. Elife. 2017;6( 28650317) 

Palazzo, Luca; Leidecker, Orsolya; Prokhorova, Evgeniia; Dauben, Helen; Matic, Ivan; Ahel, Ivan. Serine is the major residue for ADP-ribosylation upon DNA damage. Elife. 2018;7( 29480802) 

Bartlett, Edward; Bonfiglio, Juan José; Prokhorova, Evgeniia; Colby, Thomas; Zobel, Florian; Ahel, Ivan; Matic, Ivan. Interplay of Histone Marks with Serine ADP-Ribosylation. Cell Reports. 2018;24(13):3488-3502.e5. 

Hanzlikova, Hana; Prokhorova, Evgeniia; Krejcikova, Katerina; Cihlarova, Zuzana; Kalasova, Ilona; Kubovciak, Jan; Sachova, Jana; Hailstone, Richard; Brazina, Jan; Ghosh, Shereen; Cirak, Sebahattin; Gleeson, Joseph G; Ahel, Ivan; Caldecott, Keith W. Pathogenic ARH3 mutations result in ADP-ribose chromatin scars during DNA strand break repair. Nature Communications. 2020;11(1):3391. 

Prokhorova, Evgeniia; Zobel, Florian; Smith, Rebecca; Zentout, Siham; Gibbs-Seymour, Ian; Schützenhofer, Kira; Peters, Alessandra; Groslambert, Joséphine; Zorzini, Valentina; Agnew, Thomas; Brognard, John; Nielsen, Michael L; Ahel, Dragana; Huet, Sébastien; Suskiewicz, Marcin J; Ahel, Ivan. Serine-linked PARP1 auto-modification controls PARP inhibitor response. Nature Communications. 2021;12(1):4055.