Anti ADPGK pAb (ATL-HPA058525)

Atlas Antibodies

Catalog No.:
ATL-HPA058525-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADP-dependent glucokinase
Gene Name: ADPGK
Alternative Gene Name: ADP-GK, DKFZp434B195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025236: 90%, ENSRNOG00000026178: 89%
Entrez Gene ID: 83440
Uniprot ID: Q9BRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLC
Gene Sequence SPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLC
Gene ID - Mouse ENSMUSG00000025236
Gene ID - Rat ENSRNOG00000026178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADPGK pAb (ATL-HPA058525)
Datasheet Anti ADPGK pAb (ATL-HPA058525) Datasheet (External Link)
Vendor Page Anti ADPGK pAb (ATL-HPA058525) at Atlas Antibodies

Documents & Links for Anti ADPGK pAb (ATL-HPA058525)
Datasheet Anti ADPGK pAb (ATL-HPA058525) Datasheet (External Link)
Vendor Page Anti ADPGK pAb (ATL-HPA058525)