Anti ADPGK pAb (ATL-HPA045194)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045194-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ADPGK
Alternative Gene Name: ADP-GK, DKFZp434B195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025236: 96%, ENSRNOG00000026178: 96%
Entrez Gene ID: 83440
Uniprot ID: Q9BRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVH |
| Gene Sequence | GPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVH |
| Gene ID - Mouse | ENSMUSG00000025236 |
| Gene ID - Rat | ENSRNOG00000026178 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADPGK pAb (ATL-HPA045194) | |
| Datasheet | Anti ADPGK pAb (ATL-HPA045194) Datasheet (External Link) |
| Vendor Page | Anti ADPGK pAb (ATL-HPA045194) at Atlas Antibodies |
| Documents & Links for Anti ADPGK pAb (ATL-HPA045194) | |
| Datasheet | Anti ADPGK pAb (ATL-HPA045194) Datasheet (External Link) |
| Vendor Page | Anti ADPGK pAb (ATL-HPA045194) |
| Citations for Anti ADPGK pAb (ATL-HPA045194) – 1 Found |
| Tandon, Amol; Birkenhagen, Jana; Nagalla, Deepthi; Kölker, Stefan; Sauer, Sven Wolfgang. ADP-dependent glucokinase as a novel onco-target for haematological malignancies. Scientific Reports. 2020;10(1):13584. PubMed |