Anti ADPGK pAb (ATL-HPA045194)

Atlas Antibodies

Catalog No.: ATL-HPA045194-25

Protein Description: ADP-dependent glucokinase
Gene Name: ADPGK
Alternative Gene Name: ADP-GK, DKFZp434B195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025236: 96%, ENSRNOG00000026178: 96%
Entrez Gene ID: 83440
Uniprot ID: Q9BRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVH
• Gene Sequence: GPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVH
• Gene ID - Mouse: ENSMUSG00000025236
• Gene ID - Rat: ENSRNOG00000026178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADPGK pAb (ATL-HPA045194) – 1 Found

Tandon, Amol; Birkenhagen, Jana; Nagalla, Deepthi; Kölker, Stefan; Sauer, Sven Wolfgang. ADP-dependent glucokinase as a novel onco-target for haematological malignancies. Scientific Reports. 2020;10(1):13584.