Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA075997-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adenosine A2a receptor
Gene Name: ADORA2A
Alternative Gene Name: ADORA2, RDC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020178: 52%, ENSRNOG00000001302: 44%
Entrez Gene ID: 135
Uniprot ID: P29274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
Gene Sequence PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
Gene ID - Mouse ENSMUSG00000020178
Gene ID - Rat ENSRNOG00000001302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation)
Datasheet Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation)
Datasheet Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation)