Anti ADORA1 pAb (ATL-HPA044383)

Atlas Antibodies

Catalog No.:
ATL-HPA044383-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adenosine A1 receptor
Gene Name: ADORA1
Alternative Gene Name: RDC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042429: 89%, ENSRNOG00000003442: 87%
Entrez Gene ID: 134
Uniprot ID: P30542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Gene Sequence NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Gene ID - Mouse ENSMUSG00000042429
Gene ID - Rat ENSRNOG00000003442
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADORA1 pAb (ATL-HPA044383)
Datasheet Anti ADORA1 pAb (ATL-HPA044383) Datasheet (External Link)
Vendor Page Anti ADORA1 pAb (ATL-HPA044383) at Atlas Antibodies

Documents & Links for Anti ADORA1 pAb (ATL-HPA044383)
Datasheet Anti ADORA1 pAb (ATL-HPA044383) Datasheet (External Link)
Vendor Page Anti ADORA1 pAb (ATL-HPA044383)