Anti ADORA1 pAb (ATL-HPA044383)
Atlas Antibodies
- SKU:
- ATL-HPA044383-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ADORA1
Alternative Gene Name: RDC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042429: 89%, ENSRNOG00000003442: 87%
Entrez Gene ID: 134
Uniprot ID: P30542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN |
Gene Sequence | NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN |
Gene ID - Mouse | ENSMUSG00000042429 |
Gene ID - Rat | ENSRNOG00000003442 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADORA1 pAb (ATL-HPA044383) | |
Datasheet | Anti ADORA1 pAb (ATL-HPA044383) Datasheet (External Link) |
Vendor Page | Anti ADORA1 pAb (ATL-HPA044383) at Atlas Antibodies |
Documents & Links for Anti ADORA1 pAb (ATL-HPA044383) | |
Datasheet | Anti ADORA1 pAb (ATL-HPA044383) Datasheet (External Link) |
Vendor Page | Anti ADORA1 pAb (ATL-HPA044383) |