Anti ADO pAb (ATL-HPA040437 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040437-25

Protein Description: 2-aminoethanethiol (cysteamine) dioxygenase
Gene Name: ADO
Alternative Gene Name: C10orf22, FLJ14547
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057134: 68%, ENSRNOG00000061064: 32%
Entrez Gene ID: 84890
Uniprot ID: Q96SZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
• Gene Sequence: GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
• Gene ID - Mouse: ENSMUSG00000057134
• Gene ID - Rat: ENSRNOG00000061064
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.