Anti ADO pAb (ATL-HPA040437 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040437-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA040437 antibody. Corresponding ADO RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 2-aminoethanethiol (cysteamine) dioxygenase
Gene Name: ADO
Alternative Gene Name: C10orf22, FLJ14547
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057134: 68%, ENSRNOG00000061064: 32%
Entrez Gene ID: 84890
Uniprot ID: Q96SZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
Gene Sequence GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
Gene ID - Mouse ENSMUSG00000057134
Gene ID - Rat ENSRNOG00000061064
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADO pAb (ATL-HPA040437 w/enhanced validation)
Datasheet Anti ADO pAb (ATL-HPA040437 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADO pAb (ATL-HPA040437 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADO pAb (ATL-HPA040437 w/enhanced validation)
Datasheet Anti ADO pAb (ATL-HPA040437 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADO pAb (ATL-HPA040437 w/enhanced validation)