Anti ADNP2 pAb (ATL-HPA007126)

Atlas Antibodies

SKU:
ATL-HPA007126-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADNP homeobox 2
Gene Name: ADNP2
Alternative Gene Name: KIAA0863, ZNF508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053950: 89%, ENSRNOG00000053370: 88%
Entrez Gene ID: 22850
Uniprot ID: Q6IQ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
Gene Sequence TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
Gene ID - Mouse ENSMUSG00000053950
Gene ID - Rat ENSRNOG00000053370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADNP2 pAb (ATL-HPA007126)
Datasheet Anti ADNP2 pAb (ATL-HPA007126) Datasheet (External Link)
Vendor Page Anti ADNP2 pAb (ATL-HPA007126) at Atlas Antibodies

Documents & Links for Anti ADNP2 pAb (ATL-HPA007126)
Datasheet Anti ADNP2 pAb (ATL-HPA007126) Datasheet (External Link)
Vendor Page Anti ADNP2 pAb (ATL-HPA007126)