Anti ADNP2 pAb (ATL-HPA007126)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007126-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ADNP2
Alternative Gene Name: KIAA0863, ZNF508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053950: 89%, ENSRNOG00000053370: 88%
Entrez Gene ID: 22850
Uniprot ID: Q6IQ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE |
| Gene Sequence | TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE |
| Gene ID - Mouse | ENSMUSG00000053950 |
| Gene ID - Rat | ENSRNOG00000053370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADNP2 pAb (ATL-HPA007126) | |
| Datasheet | Anti ADNP2 pAb (ATL-HPA007126) Datasheet (External Link) |
| Vendor Page | Anti ADNP2 pAb (ATL-HPA007126) at Atlas Antibodies |
| Documents & Links for Anti ADNP2 pAb (ATL-HPA007126) | |
| Datasheet | Anti ADNP2 pAb (ATL-HPA007126) Datasheet (External Link) |
| Vendor Page | Anti ADNP2 pAb (ATL-HPA007126) |