Anti ADNP2 pAb (ATL-HPA007126)

Atlas Antibodies

SKU: ATL-HPA007126-25

• 
• 
• 

Protein Description: ADNP homeobox 2
Gene Name: ADNP2
Alternative Gene Name: KIAA0863, ZNF508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053950: 89%, ENSRNOG00000053370: 88%
Entrez Gene ID: 22850
Uniprot ID: Q6IQ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
• Gene Sequence: TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
• Gene ID - Mouse: ENSMUSG00000053950
• Gene ID - Rat: ENSRNOG00000053370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.