Anti ADM pAb (ATL-HPA068955)

Atlas Antibodies

Catalog No.:
ATL-HPA068955-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adrenomedullin
Gene Name: ADM
Alternative Gene Name: AM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030790: 61%, ENSRNOG00000027030: 64%
Entrez Gene ID: 133
Uniprot ID: P35318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS
Gene Sequence ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS
Gene ID - Mouse ENSMUSG00000030790
Gene ID - Rat ENSRNOG00000027030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADM pAb (ATL-HPA068955)
Datasheet Anti ADM pAb (ATL-HPA068955) Datasheet (External Link)
Vendor Page Anti ADM pAb (ATL-HPA068955) at Atlas Antibodies

Documents & Links for Anti ADM pAb (ATL-HPA068955)
Datasheet Anti ADM pAb (ATL-HPA068955) Datasheet (External Link)
Vendor Page Anti ADM pAb (ATL-HPA068955)