Anti ADK pAb (ATL-HPA075222)
Atlas Antibodies
- SKU:
- ATL-HPA075222-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 89%, ENSRNOG00000012325: 85%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD |
Gene Sequence | DDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD |
Gene ID - Mouse | ENSMUSG00000039197 |
Gene ID - Rat | ENSRNOG00000012325 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADK pAb (ATL-HPA075222) | |
Datasheet | Anti ADK pAb (ATL-HPA075222) Datasheet (External Link) |
Vendor Page | Anti ADK pAb (ATL-HPA075222) at Atlas Antibodies |
Documents & Links for Anti ADK pAb (ATL-HPA075222) | |
Datasheet | Anti ADK pAb (ATL-HPA075222) Datasheet (External Link) |
Vendor Page | Anti ADK pAb (ATL-HPA075222) |