Anti ADK pAb (ATL-HPA038409 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038409-25

• 
• 
• 

Protein Description: adenosine kinase
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 96%, ENSRNOG00000012325: 96%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
• Gene Sequence: LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
• Gene ID - Mouse: ENSMUSG00000039197
• Gene ID - Rat: ENSRNOG00000012325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADK pAb (ATL-HPA038409 w/enhanced validation) – 1 Found

Kim, Jang Keun; Cho, Jun; Kim, Se Hoon; Kang, Hoon-Chul; Kim, Dong-Seok; Kim, V Narry; Lee, Jeong Ho. Brain somatic mutations in MTOR reveal translational dysregulations underlying intractable focal epilepsy. The Journal Of Clinical Investigation. 2019;129(10):4207-4223.