Anti ADK pAb (ATL-HPA038409 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038409-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 96%, ENSRNOG00000012325: 96%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK |
| Gene Sequence | LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK |
| Gene ID - Mouse | ENSMUSG00000039197 |
| Gene ID - Rat | ENSRNOG00000012325 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADK pAb (ATL-HPA038409 w/enhanced validation) | |
| Datasheet | Anti ADK pAb (ATL-HPA038409 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADK pAb (ATL-HPA038409 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADK pAb (ATL-HPA038409 w/enhanced validation) | |
| Datasheet | Anti ADK pAb (ATL-HPA038409 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADK pAb (ATL-HPA038409 w/enhanced validation) |
| Citations for Anti ADK pAb (ATL-HPA038409 w/enhanced validation) – 1 Found |
| Kim, Jang Keun; Cho, Jun; Kim, Se Hoon; Kang, Hoon-Chul; Kim, Dong-Seok; Kim, V Narry; Lee, Jeong Ho. Brain somatic mutations in MTOR reveal translational dysregulations underlying intractable focal epilepsy. The Journal Of Clinical Investigation. 2019;129(10):4207-4223. PubMed |