Anti ADK pAb (ATL-HPA038391)

Atlas Antibodies

SKU:
ATL-HPA038391-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenosine kinase
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 93%, ENSRNOG00000012325: 93%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGF
Gene Sequence CIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGF
Gene ID - Mouse ENSMUSG00000039197
Gene ID - Rat ENSRNOG00000012325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADK pAb (ATL-HPA038391)
Datasheet Anti ADK pAb (ATL-HPA038391) Datasheet (External Link)
Vendor Page Anti ADK pAb (ATL-HPA038391) at Atlas Antibodies

Documents & Links for Anti ADK pAb (ATL-HPA038391)
Datasheet Anti ADK pAb (ATL-HPA038391) Datasheet (External Link)
Vendor Page Anti ADK pAb (ATL-HPA038391)