Anti ADIPOR2 pAb (ATL-HPA043737)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043737-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ADIPOR2
Alternative Gene Name: ACDCR2, PAQR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030168: 68%, ENSRNOG00000007990: 70%
Entrez Gene ID: 79602
Uniprot ID: Q86V24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS |
| Gene Sequence | CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS |
| Gene ID - Mouse | ENSMUSG00000030168 |
| Gene ID - Rat | ENSRNOG00000007990 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADIPOR2 pAb (ATL-HPA043737) | |
| Datasheet | Anti ADIPOR2 pAb (ATL-HPA043737) Datasheet (External Link) |
| Vendor Page | Anti ADIPOR2 pAb (ATL-HPA043737) at Atlas Antibodies |
| Documents & Links for Anti ADIPOR2 pAb (ATL-HPA043737) | |
| Datasheet | Anti ADIPOR2 pAb (ATL-HPA043737) Datasheet (External Link) |
| Vendor Page | Anti ADIPOR2 pAb (ATL-HPA043737) |
| Citations for Anti ADIPOR2 pAb (ATL-HPA043737) – 1 Found |
| Guan, Guofang; Zhang, Dejun; Zheng, Ying; Wen, Lianji; Yu, Duojiao; Lu, Yanqing; Zhao, Yan. microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma. International Journal Of Clinical And Experimental Pathology. 7(9):5683-91. PubMed |