Anti ADIPOR2 pAb (ATL-HPA043737)

Atlas Antibodies

Catalog No.:
ATL-HPA043737-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adiponectin receptor 2
Gene Name: ADIPOR2
Alternative Gene Name: ACDCR2, PAQR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030168: 68%, ENSRNOG00000007990: 70%
Entrez Gene ID: 79602
Uniprot ID: Q86V24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS
Gene Sequence CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS
Gene ID - Mouse ENSMUSG00000030168
Gene ID - Rat ENSRNOG00000007990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADIPOR2 pAb (ATL-HPA043737)
Datasheet Anti ADIPOR2 pAb (ATL-HPA043737) Datasheet (External Link)
Vendor Page Anti ADIPOR2 pAb (ATL-HPA043737) at Atlas Antibodies

Documents & Links for Anti ADIPOR2 pAb (ATL-HPA043737)
Datasheet Anti ADIPOR2 pAb (ATL-HPA043737) Datasheet (External Link)
Vendor Page Anti ADIPOR2 pAb (ATL-HPA043737)
Citations for Anti ADIPOR2 pAb (ATL-HPA043737) – 1 Found
Guan, Guofang; Zhang, Dejun; Zheng, Ying; Wen, Lianji; Yu, Duojiao; Lu, Yanqing; Zhao, Yan. microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma. International Journal Of Clinical And Experimental Pathology. 7(9):5683-91.  PubMed