Anti ADIPOQ pAb (ATL-HPA051767)

Atlas Antibodies

Catalog No.:
ATL-HPA051767-100
Shipping:
Calculated at Checkout
$520.00
Adding to cart… The item has been added
Protein Description: adiponectin, C1Q and collagen domain containing
Gene Name: ADIPOQ
Alternative Gene Name: ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022878: 92%, ENSRNOG00000001821: 92%
Entrez Gene ID: 9370
Uniprot ID: Q15848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
Gene Sequence YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
Gene ID - Mouse ENSMUSG00000022878
Gene ID - Rat ENSRNOG00000001821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADIPOQ pAb (ATL-HPA051767)
Datasheet Anti ADIPOQ pAb (ATL-HPA051767) Datasheet (External Link)
Vendor Page Anti ADIPOQ pAb (ATL-HPA051767) at Atlas Antibodies

Documents & Links for Anti ADIPOQ pAb (ATL-HPA051767)
Datasheet Anti ADIPOQ pAb (ATL-HPA051767) Datasheet (External Link)
Vendor Page Anti ADIPOQ pAb (ATL-HPA051767)