Anti ADIPOQ pAb (ATL-HPA051767)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051767-100
- Shipping:
- Calculated at Checkout
$520.00
Gene Name: ADIPOQ
Alternative Gene Name: ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022878: 92%, ENSRNOG00000001821: 92%
Entrez Gene ID: 9370
Uniprot ID: Q15848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL |
| Gene Sequence | YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL |
| Gene ID - Mouse | ENSMUSG00000022878 |
| Gene ID - Rat | ENSRNOG00000001821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADIPOQ pAb (ATL-HPA051767) | |
| Datasheet | Anti ADIPOQ pAb (ATL-HPA051767) Datasheet (External Link) |
| Vendor Page | Anti ADIPOQ pAb (ATL-HPA051767) at Atlas Antibodies |
| Documents & Links for Anti ADIPOQ pAb (ATL-HPA051767) | |
| Datasheet | Anti ADIPOQ pAb (ATL-HPA051767) Datasheet (External Link) |
| Vendor Page | Anti ADIPOQ pAb (ATL-HPA051767) |