Anti ADI1 pAb (ATL-HPA035404)

Atlas Antibodies

Catalog No.:
ATL-HPA035404-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acireductone dioxygenase 1
Gene Name: ADI1
Alternative Gene Name: APL1, ARD, FLJ10913, HMFT1638, MTCBP-1, mtnD, SIPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020629: 88%, ENSRNOG00000008950: 88%
Entrez Gene ID: 55256
Uniprot ID: Q9BV57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEAR
Gene Sequence FYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEAR
Gene ID - Mouse ENSMUSG00000020629
Gene ID - Rat ENSRNOG00000008950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADI1 pAb (ATL-HPA035404)
Datasheet Anti ADI1 pAb (ATL-HPA035404) Datasheet (External Link)
Vendor Page Anti ADI1 pAb (ATL-HPA035404) at Atlas Antibodies

Documents & Links for Anti ADI1 pAb (ATL-HPA035404)
Datasheet Anti ADI1 pAb (ATL-HPA035404) Datasheet (External Link)
Vendor Page Anti ADI1 pAb (ATL-HPA035404)