Anti ADI1 pAb (ATL-HPA035403)

Atlas Antibodies

SKU: ATL-HPA035403-25

• 
• 
• 

Protein Description: acireductone dioxygenase 1
Gene Name: ADI1
Alternative Gene Name: APL1, ARD, FLJ10913, HMFT1638, MTCBP-1, mtnD, SIPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020629: 84%, ENSRNOG00000008950: 84%
Entrez Gene ID: 55256
Uniprot ID: Q9BV57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIK
• Gene Sequence: AWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIK
• Gene ID - Mouse: ENSMUSG00000020629
• Gene ID - Rat: ENSRNOG00000008950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.