Anti ADHFE1 pAb (ATL-HPA023062 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023062-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-ADHFE1 antibody. Corresponding ADHFE1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
  • Western blot analysis in human cell line HDLM-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alcohol dehydrogenase, iron containing, 1
Gene Name: ADHFE1
Alternative Gene Name: ADHFe1, FLJ32430
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025911: 86%, ENSRNOG00000007069: 85%
Entrez Gene ID: 137872
Uniprot ID: Q8IWW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKL
Gene Sequence LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKL
Gene ID - Mouse ENSMUSG00000025911
Gene ID - Rat ENSRNOG00000007069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ADHFE1 pAb (ATL-HPA023062 w/enhanced validation)
Datasheet Anti ADHFE1 pAb (ATL-HPA023062 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADHFE1 pAb (ATL-HPA023062 w/enhanced validation)