Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039695-25
  • Immunohistochemistry analysis in human esophagus and pancreas tissues using HPA039695 antibody. Corresponding ADH7 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Gene Name: ADH7
Alternative Gene Name: ADH-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055301: 86%, ENSRNOG00000032959: 81%
Entrez Gene ID: 131
Uniprot ID: P40394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Gene Sequence KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Gene ID - Mouse ENSMUSG00000055301
Gene ID - Rat ENSRNOG00000032959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation)
Datasheet Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation)
Datasheet Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation)