Anti ADH7 pAb (ATL-HPA039695 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039695-25

Protein Description: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Gene Name: ADH7
Alternative Gene Name: ADH-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055301: 86%, ENSRNOG00000032959: 81%
Entrez Gene ID: 131
Uniprot ID: P40394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
• Gene Sequence: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
• Gene ID - Mouse: ENSMUSG00000055301
• Gene ID - Rat: ENSRNOG00000032959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.